PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33804-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 304aa    MW: 32815.8 Da    PI: 4.3652
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33804-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.6e-11144195455
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +k+ +r ++NR +A +sR+RKk +++ Le+++k Leae ++L   l+    e
  TRIUR3_33804-P1 144 SKKKMRQMRNRDSAMKSRERKKSYVKDLETRSKYLEAECRRLSYALQCCAAE 195
                      699************************************9998777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-4141205IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.3E-12141203No hitNo description
PROSITE profilePS502179.266143185IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.38E-10145203No hitNo description
PfamPF001706.6E-9145201IPR004827Basic-leucine zipper domain
CDDcd147043.02E-13146197No hitNo description
PROSITE patternPS000360149163IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDTDLDLDAL LASFAGESAA VSELLAPPPL DAAEAGSPES VTSRSSPAGE EVLSEIERFL  60
MQEEEAAGAG AEPVDGISVD EFLDALFDGA EEGGEKGNGS EAEAGGSTDG DSRRGEEGVE  120
VVTPETEVEV VTPETEVDGD DPISKKKMRQ MRNRDSAMKS RERKKSYVKD LETRSKYLEA  180
ECRRLSYALQ CCAAENMALR QNMLKDRPIG AHTAMQESAV LSETLPLVSL LWLVSIVCLF  240
LTPGLPNRSL AAPRRAERGL TMVAGKPSSD QPETLELLLH GRRWRGTRER IKLDTPPLRA  300
AAAC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3655050.0AK365505.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034K24.
GenBankAK3699570.0AK369957.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2101P04.
GenBankAK3701490.0AK370149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2105L10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563606.11e-133PREDICTED: bZIP transcription factor 60
TrEMBLM7YC230.0M7YC23_TRIUA; BZIP transcription factor 60
STRINGMLOC_22013.11e-152(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.14e-14basic region/leucine zipper motif 60